Protein Info for b1499 in Escherichia coli BW25113

Name: ydeO
Annotation: predicted DNA-binding transcriptional acfivator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12833: HTH_18
  • amino acids 157 to 231 (75 residues), 58.3 bits, E=7.9e-20
• PF00165: HTH_AraC
  • amino acids 199 to 229 (31 residues), 31.2 bits, 1.8e-11

Best Hits

Swiss-Prot: 100% identical to YDEO_ECOLI: HTH-type transcriptional regulator YdeO (ydeO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1499)

Predicted SEED Role

"Putative formate dehydrogenase oxidoreductase protein" in subsystem Formate hydrogenase

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• oxalate degradation VI (2/4 steps found)
• oxalate degradation III (2/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

Sequence Analysis Tools

See P76135 at UniProt or InterPro

Protein Sequence (253 amino acids)

>b1499 predicted DNA-binding transcriptional acfivator (NCBI) (Escherichia coli BW25113)
MSLVCSVIFIHHAFNANILDKDYAFSDGEILMVDNAVRTHFEPYERHFKEIGFTENTIKK
YLQCTNIQTVTVPVPAKFLRASNVPTGLLNEMIAYLNSEERNHHNFSELLLFSCLSIFAA
CKGFITLLTNGVLSVSGKVRNIVNMKPAHPWKLKDICDCLYISESLLKKKLKQEQTTFSQ
ILLDARMQHAKNLIRVEGSVNKIAEQCGYASTSYFIYAFRKHFGNSPKRVSKEYRCQSHT
GMNTGNTMNALAI