Protein Info for b1498 in Escherichia coli BW25113

Name: b1498
Annotation: putative sulfatase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00884: Sulfatase" amino acids 58 to 408 (351 residues), 238.9 bits, see alignment E=1.3e-74 PF01663: Phosphodiest" amino acids 105 to 348 (244 residues), 30.7 bits, see alignment E=3.8e-11 PF16347: SGSH_C" amino acids 368 to 437 (70 residues), 30.9 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 100% identical to YDEN_ECOLI: Uncharacterized sulfatase YdeN (ydeN) from Escherichia coli (strain K12)

KEGG orthology group: K01138, uncharacterized sulfatase [EC: 3.1.6.-] (inferred from 100% identity to eco:b1498)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.-

Use Curated BLAST to search for 3.1.6.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77318 at UniProt or InterPro

Protein Sequence (560 amino acids)

>b1498 putative sulfatase (VIMSS) (Escherichia coli BW25113)
MKSALKKSVVSTSISLILASGMAAFAAHAADDVKLKATKTNVAFSDFTPTEYSTKGKPNI
IVLTMDDLGYGQLPFDKGSFDPKTMENREVVDTYKIGIDKAIEAAQKSTPTLLSLMDEGV
RFTNGYVAHGVSGPSRAAIMTGRAPARFGVYSNTDAQDGIPLTETFLPELFQNHGYYTAA
VGKWHLSKISNVPVPEDKQTRDYHDNFTTFSAEEWQPQNRGFDYFMGFHAAGTAYYNSPS
LFKNRERVPAKGYISDQLTDEAIGVVDRAKTLDQPFMLYLAYNAPHLPNDNPAPDQYQKQ
FNTGSQTADNYYASVYSVDQGVKRILEQLKKNGQYDNTIILFTSDNGAVIDGPLPLNGAQ
KGYKSQTYPGGTHTPMFMWWKGKLQPGNYDKLISAMDFYPTALDAADISIPKDLKLDGVS
LLPWLQDKKQGEPHKNLTWITSYSHWFDEENIPFWDNYHKFVRHQSDDYPHNPNTEDLSQ
FSYTVRNNDYSLVYTVENNQLGLYKLTDLQQKDNLAAANPQVVKEMQGVVREFIDSSQPP
LSEVNQEKFNNIKKALSEAK