Protein Info for b1492 in Escherichia coli BW25113

Name: gadC
Annotation: predicted glutamate:gamma-aminobutyric acid antiporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 90 to 116 (27 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details amino acids 444 to 466 (23 residues), see Phobius details TIGR00910: glutamate:gamma-aminobutyrate antiporter" amino acids 1 to 511 (511 residues), 1029.5 bits, see alignment E=0 PF13520: AA_permease_2" amino acids 13 to 452 (440 residues), 209.3 bits, see alignment E=1.1e-65 PF00324: AA_permease" amino acids 36 to 462 (427 residues), 77.3 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 100% identical to GADC_ECOLI: Probable glutamate/gamma-aminobutyrate antiporter (gadC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1492)

MetaCyc: 100% identical to L-glutamate:4-aminobutyrate antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1549; TRANS-RXN-261

Predicted SEED Role

"Probable glutamate/gamma-aminobutyrate antiporter" in subsystem Acid resistance mechanisms

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P63235 at UniProt or InterPro

Protein Sequence (511 amino acids)

>b1492 predicted glutamate:gamma-aminobutyric acid antiporter (NCBI) (Escherichia coli BW25113)
MATSVQTGKAKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLC
AAEMATVDGWEEGGVFAWVSNTLGPRWGFAAISFGYLQIAIGFIPMLYFVLGALSYILKW
PALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGFFAGILLPAFILIALAAIYLH
SGAPVAIEMDSKTFFPDFSKVGTLVVFVAFILSYMGVEASATHVNEMSNPGRDYPLAMLL
LMVAAICLSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRVISALLLLG
VLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIILTNTG
GGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLKRTFNIPGGKGVKLVVAIVGL
LTSIMAFIVSFLPPDNIQGDSTDMYVELLVVSFLVVLALPFILYAVHDRKGKANTGVTLE
PINSQNAPKGHFFLHPRARSPHYIVMNDKKH