Protein Info for b1482 in Escherichia coli BW25113

Name: osmC
Annotation: osmotically inducible, stress-inducible membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03562: peroxiredoxin, OsmC subfamily
  • amino acids 5 to 138 (134 residues), 203.9 bits, E=4.8e-65
• PF02566: OsmC
  • amino acids 43 to 138 (96 residues), 67.5 bits, E=6.1e-23

Best Hits

Swiss-Prot: 100% identical to OSMC_ECOLI: Peroxiredoxin OsmC (osmC) from Escherichia coli (strain K12)

KEGG orthology group: K04063, osmotically inducible protein OsmC (inferred from 100% identity to eco:b1482)

MetaCyc: 100% identical to osmotically inducible peroxiredoxin OsmC (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Osmotically inducible protein C"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.24

Sequence Analysis Tools

See P0C0L2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>b1482 osmotically inducible, stress-inducible membrane protein (NCBI) (Escherichia coli BW25113)
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACF
SMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQK
AKAGCPVSQVLKAEITLDYQLKS