Protein Info for b1475 in Escherichia coli BW25113

Name: fdnH
Annotation: formate dehydrogenase-N, Fe-S (beta) subunit, nitrate-inducible (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 7 to 290 (284 residues), 481.8 bits, E=2.7e-149
• PF12800: Fer4_4
  • amino acids 37 to 51 (15 residues), 16.1 bits, see alignment (E = 6.1e-06)
  • amino acids 131 to 145 (15 residues), 15.4 bits, see alignment (E = 9.8e-06)
• PF12838: Fer4_7
  • amino acids 38 to 114 (77 residues), 37.7 bits, E=1.2e-12
• PF13247: Fer4_11
  • amino acids 92 to 188 (97 residues), 89.7 bits, E=6.2e-29
• PF13237: Fer4_10
  • amino acids 94 to 144 (51 residues), 31.4 bits, 7.9e-11
• PF12837: Fer4_6
  • amino acids 125 to 147 (23 residues), 24.4 bits, see alignment (E = 1e-08)
• PF00037: Fer4
  • amino acids 130 to 147 (18 residues), 22.6 bits, see alignment (E = 3.7e-08)
• PF09163: Form-deh_trans
  • amino acids 246 to 289 (44 residues), 70.5 bits, 4.1e-23

Best Hits

Swiss-Prot: 100% identical to FDNH_SHIFL: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Shigella flexneri

KEGG orthology group: K08349, formate dehydrogenase-N, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to eco:b1475)

MetaCyc: 100% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• formate to trimethylamine N-oxide electron transfer (2/2 steps found)
• nitrate reduction III (dissimilatory) (2/2 steps found)
• formate to nitrite electron transfer (2/3 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See P0AAJ3 at UniProt or InterPro

Protein Sequence (294 amino acids)

>b1475 formate dehydrogenase-N, Fe-S (beta) subunit, nitrate-inducible (NCBI) (Escherichia coli BW25113)
MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGL
PKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEEDHHE