Protein Info for b1473 in Escherichia coli BW25113

Name: yddG
Annotation: predicted methyl viologen efflux pump (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details PF00892: EamA" amino acids 5 to 137 (133 residues), 31.5 bits, see alignment E=9.2e-12 amino acids 158 to 285 (128 residues), 37 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 100% identical to YDDG_ECOLI: Aromatic amino acid exporter YddG (yddG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1473)

MetaCyc: 100% identical to amino acid exporter YddG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-265

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46136 at UniProt or InterPro

Protein Sequence (293 amino acids)

>b1473 predicted methyl viologen efflux pump (RefSeq) (Escherichia coli BW25113)
MTRQKATLIGLIAIVLWSTMVGLIRGVSEGLGPVGGAAAIYSLSGLLLIFTVGFPRIRQI
PKGYLLAGSLLFVSYEICLALSLGYAATHHQAIEVGMVNYLWPSLTILFAILFNGQKTNW
LIVPGLLLALVGVCWVLGGDNGLHYDEIINNITTSPLSYFLAFIGAFIWAAYCTVTNKYA
RGFNGITVFVLLTGASLWVYYFLTPQPEMIFSTPVMIKLISAAFTLGFAYAAWNVGILHG
NVTIMAVGSYFTPVLSSALAAVLLSAPLSFSFWQGALMVCGGSLLCWLATRRG