Protein Info for b1470 in Escherichia coli BW25113

Name: yddJ
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YDDJ_ECOLI: Putative protein YddJ (yddJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1470)

Predicted SEED Role

"internalin, putative" in subsystem Listeria surface proteins: Internalin-like proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76122 at UniProt or InterPro

Protein Sequence (111 amino acids)

>b1470 hypothetical protein (NCBI) (Escherichia coli BW25113)
MQLMLFNLFSPALKLNTGLAILSPGAFEVHSDGIDVDNELFHYPIKKAYTPYNIHTYKTE
EVVNQMNIKVKNMTLDEINNTYCNNDYYNQAIREEPIDLLDRSFSSSSWPF