Protein Info for b1453 in Escherichia coli BW25113

Name: ansP
Annotation: L-asparagine permease (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 35 to 459 (425 residues), 135.8 bits, see alignment E=2.1e-43 PF00324: AA_permease" amino acids 35 to 476 (442 residues), 458.6 bits, see alignment E=2.4e-141

Best Hits

Swiss-Prot: 100% identical to ANSP_ECOLI: L-asparagine permease (ansP) from Escherichia coli (strain K12)

KEGG orthology group: K11738, L-asparagine permease (inferred from 100% identity to eco:b1453)

Predicted SEED Role

"L-asparagine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77610 at UniProt or InterPro

Protein Sequence (499 amino acids)

>b1453 L-asparagine permease (VIMSS) (Escherichia coli BW25113)
MSKHDTDTSDQHAAKRRWLNAHEEGYHKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAG
PALALVYLICGLFSFFILRALGELVLHRPSSGSFVSYAREFLGEKAAYVAGWMYFINWAM
TGIVDITAVALYMHYWGAFGGVPQWVFALAALTIVGTMNMIGVKWFAEMEFWFALIKVLA
IVTFLVVGTVFLGSGQPLDGNTTGFHLITDNGGFFPHGLLPALVLIQGVVFAFASIEMVG
TAAGECKDPQTMVPKAINSVIWRIGLFYVGSVVLLVMLLPWSAYQAGQSPFVTFFSKLGV
PYIGSIMNIVVLTAALSSLNSGLYCTGRILRSMAMGGSAPSFMAKMSRQHVPYAGILATL
VVYVVGVFLNYLVPSRVFEIVLNFASLGIIASWAFIIVCQMRLRKAIKEGKAADVSFKLP
GAPFTSWLTLLFLLSVLVLMAFDYPNGTYTIAALPIIGILLVIGWFGVRKRVAEIHSTAP
VVEEDEEKQEIVFKPETAS