Protein Info for b1448 in Escherichia coli BW25113

Name: yncA
Annotation: predicted acyltransferase with acyl-CoA N-acyltransferase domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF13420: Acetyltransf_4" amino acids 3 to 155 (153 residues), 50 bits, see alignment E=1.2e-16 PF13302: Acetyltransf_3" amino acids 3 to 137 (135 residues), 45.2 bits, see alignment E=5.7e-15 PF00583: Acetyltransf_1" amino acids 16 to 136 (121 residues), 75.5 bits, see alignment E=1.4e-24 PF13673: Acetyltransf_10" amino acids 50 to 142 (93 residues), 38.9 bits, see alignment E=2.9e-13 PF13508: Acetyltransf_7" amino acids 53 to 137 (85 residues), 48.9 bits, see alignment E=2.5e-16 PF12746: GNAT_acetyltran" amino acids 76 to 138 (63 residues), 28.2 bits, see alignment E=4.9e-10 PF08445: FR47" amino acids 84 to 139 (56 residues), 34.9 bits, see alignment E=4.4e-12

Best Hits

Swiss-Prot: 100% identical to MNAT_ECOLI: L-amino acid N-acyltransferase MnaT (mnaT) from Escherichia coli (strain K12)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to eco:b1448)

MetaCyc: 100% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"Putative acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76112 at UniProt or InterPro

Protein Sequence (172 amino acids)

>b1448 predicted acyltransferase with acyl-CoA N-acyltransferase domain (NCBI) (Escherichia coli BW25113)
MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYPVLVSEENG
VVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGI
ESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLDERTEPDAIG