Protein Info for b1441 in Escherichia coli BW25113

Name: ydcT
Annotation: predicted spermidine/putrescine transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 118.9 bits, see alignment E=2.8e-38 PF08402: TOBE_2" amino acids 257 to 331 (75 residues), 61.3 bits, see alignment E=7.8e-21

Best Hits

Swiss-Prot: 100% identical to YDCT_ECOLI: Uncharacterized ABC transporter ATP-binding protein YdcT (ydcT) from Escherichia coli (strain K12)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to eco:b1441)

MetaCyc: 100% identical to putative ABC transporter ATP-binding protein YdcT (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77795 at UniProt or InterPro

Protein Sequence (337 amino acids)

>b1441 predicted spermidine/putrescine transporter subunit (NCBI) (Escherichia coli BW25113)
MTYAVEFDNVSRLYGDVRAVDGVSIAIKDGEFFSMLGPSGSGKTTCLRLIAGFEQLSGGA
ISIFGKPASNLPPWERDVNTVFQDYALFPHMSILDNVAYGLMVKGVNKKQRHAMAQEALE
KVALGFVHQRKPSQLSGGQRQRVAIARALVNEPRVLLLDEPLGALDLKLREQMQLELKKL
QQSLGITFIFVTHDQGEALSMSDRVAVFNNGRIEQVDSPRDLYMRPRTPFVAGFVGTSNV
FDGLMAEKLCGMTGSFALRPEHIRLNTPGELQANGTIQAVQYQGAATRFELKLNGGEKLL
VSQANMTGEELPATLTPGQQVMVSWSRDVMVPLVEER