Protein Info for b1433 in Escherichia coli BW25113

Name: b1433
Annotation: putative membrane transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 25 to 31 (7 residues), see Phobius details amino acids 35 to 36 (2 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 237 to 276 (40 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 349 to 382 (34 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 1 to 382 (382 residues), 703.6 bits, see alignment E=3.4e-216 PF03594: BenE" amino acids 6 to 381 (376 residues), 538.8 bits, see alignment E=3.3e-166

Best Hits

Swiss-Prot: 100% identical to YDCO_ECOLI: Inner membrane protein YdcO (ydcO) from Escherichia coli (strain K12)

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 100% identity to eco:b1433)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76103 at UniProt or InterPro

Protein Sequence (391 amino acids)

>b1433 putative membrane transport protein (VIMSS) (Escherichia coli BW25113)
MRLFSIPPPTLLAGFLAVLIGYASSAAIIWQAAIVAGATTAQISGWMTALGLAMGVSTLT
LTLWYRVPVLTAWSTPGAALLVTGLQGLTLNEAIGVFIVTNALIVLCGITGLFARLMRII
PHSLAAAMLAGILLRFGLQAFASLDGQFTLCGSMLLVWLATKAVAPRYAVIAAMIIGIVI
VIAQGDVVTTDVVFKPVLPTYITPDFSFAHSLSVALPLFLVTMASQNAPGIAAMKAAGYS
APVSPLIVFTGLLALVFSPFGVYSVGIAAITAAICQSPEAHPDKDQRWLAAAVAGIFYLL
AGLFGSAITGMMAALPVSWIQMLAGLALLSTIGGSLYQALHNERERDAAVVAFLVTASGL
TLVGIGSAFWGLIAGGVCYVVLNLIADRNRY