Protein Info for b1406 in Escherichia coli BW25113

Name: ydbC
Annotation: predicted oxidoreductase, NAD(P)-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00248: Aldo_ket_red" amino acids 15 to 284 (270 residues), 164.4 bits, see alignment E=1.7e-52

Best Hits

Swiss-Prot: 100% identical to PDXI_ECOLI: Pyridoxine 4-dehydrogenase (pdxI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1406)

MetaCyc: 100% identical to pyridoxal reductase (Escherichia coli K-12 substr. MG1655)
Pyridoxine 4-dehydrogenase. [EC: 1.1.1.65]; RXN0-7143 [EC: 1.1.1.65]

Predicted SEED Role

"Aldo-keto reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25906 at UniProt or InterPro

Protein Sequence (286 amino acids)

>b1406 predicted oxidoreductase, NAD(P)-binding (NCBI) (Escherichia coli BW25113)
MSSNTFTLGTKSVNRLGYGAMQLAGPGVFGPPRDRHVAITVLREALALGVNHIDTSDFYG
PHVTNQIIREALYPYSDDLTIVTKIGARRGEDASWLPAFSPAELQKAVHDNLRNLGLDVL
DVVNLRVMMGDGHGPAEGSIEASLTVLAEMQQQGLVKHIGLSNVTPTQVAEARKIAEIVC
VQNEYNIAHRADDAMIDALAHDGIAYVPFFPLGGFTPLQSSTLSDVAASLGATPMQVALA
WLLQRSPNILLIPGTSSVAHLRENMAAEKLHLSEEVLSTLDGISRE