Protein Info for b1399 in Escherichia coli BW25113

Name: paaX
Annotation: DNA-binding transcriptional repressor of phenylacetic acid degradation, aryl-CoA responsive (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF07848: PaaX" amino acids 19 to 87 (69 residues), 100.9 bits, see alignment E=5.5e-33 TIGR02277: phenylacetic acid degradation operon negative regulatory protein PaaX" amino acids 21 to 302 (282 residues), 410.8 bits, see alignment E=1.6e-127 PF20803: PaaX_M" amino acids 104 to 173 (70 residues), 32.5 bits, see alignment E=1.1e-11 PF08223: PaaX_C" amino acids 190 to 280 (91 residues), 100.3 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 100% identical to PAAX_ECOLI: Transcriptional repressor PaaX (paaX) from Escherichia coli (strain K12)

KEGG orthology group: K02616, phenylacetic acid degradation operon negative regulatory protein (inferred from 100% identity to eco:b1399)

Predicted SEED Role

"Phenylacetic acid degradation operon negative regulatory protein PaaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76086 at UniProt or InterPro

Protein Sequence (316 amino acids)

>b1399 DNA-binding transcriptional repressor of phenylacetic acid degradation, aryl-CoA responsive (NCBI) (Escherichia coli BW25113)
MSKLDTFIQHAVNAVPVSGTSLISSLYGDSLSHRGGEIWLGSLAALLEGLGFGERFVRTA
LFRLNKEGWLDVSRIGRRSFYSLSDKGLRLTRRAESKIYRAEQPAWDGKWLLLLSEGLDK
STLADVKKQLIWQGFGALAPSLMASPSQKLADVQTLLHEAGVADNVICFEAQIPLALSRA
ALRARVEECWHLTEQNAMYETFIQSFRPLVPLLKEAADELTPERAFHIQLLLIHFYRRVV
LKDPLLPEELLPAHWAGHTARQLCINIYQRVAPAALAFVSEKGETSVGELPAPGSLYFQR
FGGLNIEQEALCQFIR