Protein Info for b1396 in Escherichia coli BW25113

Name: paaI
Annotation: predicted thioesterase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00369: uncharacterized domain 1" amino acids 18 to 130 (113 residues), 140 bits, see alignment E=3.5e-45 TIGR02286: phenylacetic acid degradation protein PaaD" amino acids 19 to 132 (114 residues), 176.6 bits, see alignment E=1.5e-56 PF13622: 4HBT_3" amino acids 48 to 122 (75 residues), 26.6 bits, see alignment E=5.9e-10 PF03061: 4HBT" amino acids 49 to 122 (74 residues), 74.7 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 100% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 100% identity to eco:b1396)

MetaCyc: 100% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76084 at UniProt or InterPro

Protein Sequence (140 amino acids)

>b1396 predicted thioesterase (NCBI) (Escherichia coli BW25113)
MSHKAWQNAHAMYENDACAKALGIDIISMDEGFAVVTMTVTAQMLNGHQSCHGGQLFSLA
DTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQK
TVALFRGKSHRIGGTITGEA