Protein Info for b1388 in Escherichia coli BW25113

Name: paaA
Annotation: predicted multicomponent oxygenase/reductase subunit for phenylacetic acid degradation (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR02156: phenylacetate-CoA oxygenase, PaaG subunit" amino acids 7 to 295 (289 residues), 516.8 bits, see alignment E=6.4e-160 PF05138: PaaA_PaaC" amino acids 17 to 291 (275 residues), 315.7 bits, see alignment E=1.1e-98

Best Hits

Swiss-Prot: 100% identical to PAAA_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit A (paaA) from Escherichia coli (strain K12)

KEGG orthology group: K02609, phenylacetic acid degradation protein (inferred from 100% identity to eco:b1388)

MetaCyc: 100% identical to phenylacetyl-CoA 1,2-epoxidase, monooxygenase subunit (Escherichia coli K-12 substr. MG1655)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaG subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76077 at UniProt or InterPro

Protein Sequence (309 amino acids)

>b1388 predicted multicomponent oxygenase/reductase subunit for phenylacetic acid degradation (NCBI) (Escherichia coli BW25113)
MTQEERFEQRIAQETAIEPQDWMPDAYRKTLIRQIGQHAHSEIVGMLPEGNWITRAPTLR
RKAILLAKVQDEAGHGLYLYSAAETLGCAREDIYQKMLDGRMKYSSIFNYPTLSWADIGV
IGWLVDGAAIVNQVALCRTSYGPYARAMVKICKEESFHQRQGFEACMALAQGSEAQKQML
QDAINRFWWPALMMFGPNDDNSPNSARSLTWKIKRFTNDELRQRFVDNTVPQVEMLGMTV
PDPDLHFDTESGHYRFGEIDWQEFNEVINGRGICNQERLDAKRKAWEEGTWVREAALAHA
QKQHARKVA