Protein Info for b1384 in Escherichia coli BW25113

Name: feaR
Annotation: DNA-binding transcriptional dual regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF14525: AraC_binding_2" amino acids 12 to 185 (174 residues), 102.2 bits, see alignment E=4.3e-33 PF12833: HTH_18" amino acids 219 to 298 (80 residues), 69.4 bits, see alignment E=4e-23 PF00165: HTH_AraC" amino acids 259 to 298 (40 residues), 44.9 bits, see alignment 1.4e-15

Best Hits

Swiss-Prot: 100% identical to FEAR_ECOLI: Transcriptional activator FeaR (feaR) from Escherichia coli (strain K12)

KEGG orthology group: K14063, AraC family transcriptional regulator, positive regulator of tynA and feaB (inferred from 100% identity to eco:b1384)

Predicted SEED Role

"Transcriptional activator feaR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47129 at UniProt or InterPro

Protein Sequence (301 amino acids)

>b1384 DNA-binding transcriptional dual regulator (NCBI) (Escherichia coli BW25113)
MNPAVDNEFQQWLSQINQVCGNFTGRLLTERYTGVLDTHFAKGLKLSTVTTSGVNLSRTW
QEVKGSDDAWFYTVFQLSGQAIMEQDERQVQIGAGDITLLDASRPCSLYWQESSKQISLL
LPRTLLEQYFPHQKPICAERLDADLPMVQLSHRLLQESMNNPALSETESEAALQAMVCLL
RPVLHQRESVQPRRERQFQKVVTLIDDNIREEILRPEWIAGETGMSVRSLYRMFADKGLV
VAQYIRNRRLDFCADAIRHAADDEKLAGIGFHWGFSDQSHFSTVFKQRFGMTPGEYRRKF
R