Protein Info for b1349 in Escherichia coli BW25113

Name: recT
Annotation: Rac prophage; recombination and repair protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR00616: recombinase, phage RecT family" amino acids 1 to 243 (243 residues), 415.5 bits, see alignment E=3.9e-129 PF03837: RecT" amino acids 53 to 244 (192 residues), 188.5 bits, see alignment E=5.1e-60

Best Hits

Swiss-Prot: 100% identical to RECT_ECOLI: Protein RecT (recT) from Escherichia coli (strain K12)

KEGG orthology group: K07455, recombination protein RecT (inferred from 100% identity to eco:b1349)

Predicted SEED Role

"Recombinational DNA repair protein RecT (prophage associated)" in subsystem DNA repair, bacterial or Listeria phi-A118-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33228 at UniProt or InterPro

Protein Sequence (269 amino acids)

>b1349 Rac prophage; recombination and repair protein (NCBI) (Escherichia coli BW25113)
MTKQPPIAKADLQKTQGNRAPAAVKNSDVISFINQPSMKEQLAAALPRHMTAERMIRIAT
TEIRKVPALGNCDTMSFVSAIVQCSQLGLEPGSALGHAYLLPFGNKNEKSGKKNVQLIIG
YRGMIDLARRSGQIASLSARVVREGDEFSFEFGLDEKLIHRPGENEDAPVTHVYAVARLK
DGGTQFEVMTRKQIELVRSLSKAGNNGPWVTHWEEMAKKTAIRRLFKYLPVSIEIQRAVS
MDEKEPLTIDPADSSVLTGEYSVIDNSEE