Protein Info for b1348 in Escherichia coli BW25113

Name: lar
Annotation: Rac prophage; restriction alleviation protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 64 PF14354: Lar_restr_allev" amino acids 5 to 54 (50 residues), 53.3 bits, see alignment E=1.3e-18 TIGR03655: restriction alleviation protein, Lar family" amino acids 6 to 54 (49 residues), 55.1 bits, see alignment E=3.7e-19

Best Hits

Swiss-Prot: 100% identical to RALR_ECOLI: Endodeoxyribonuclease toxin RalR (ralR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1348)

MetaCyc: 100% identical to Rac prophage; endodeoxyribonuclease toxin RalR (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

"Restriction alleviation and modification enhancement protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33229 at UniProt or InterPro

Protein Sequence (64 amino acids)

>b1348 Rac prophage; restriction alleviation protein (NCBI) (Escherichia coli BW25113)
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG
GVHV