Protein Info for b1337 in Escherichia coli BW25113

Name: abgB
Annotation: predicted peptidase, aminobenzoyl-glutamate utilization protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 TIGR01891: amidohydrolase" amino acids 19 to 433 (415 residues), 444.8 bits, see alignment E=1.2e-137 PF01546: Peptidase_M20" amino acids 78 to 308 (231 residues), 33.4 bits, see alignment E=4.6e-12 PF07687: M20_dimer" amino acids 191 to 280 (90 residues), 21.2 bits, see alignment E=2.3e-08

Best Hits

Swiss-Prot: 100% identical to ABGB_ECOLI: p-aminobenzoyl-glutamate hydrolase subunit B (abgB) from Escherichia coli (strain K12)

KEGG orthology group: K12941, aminobenzoyl-glutamate utilization protein B (inferred from 100% identity to eco:b1337)

MetaCyc: 100% identical to p-aminobenzoyl-glutamate hydrolase subunit B (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit B" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76052 at UniProt or InterPro

Protein Sequence (481 amino acids)

>b1337 predicted peptidase, aminobenzoyl-glutamate utilization protein (NCBI) (Escherichia coli BW25113)
MQEIYRFIDDAIEADRQRYTDIADQIWDHPETRFEEFWSAEHLASALESAGFTVTRNVGN
IPNAFIASFGQGKPVIALLGEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFA
AAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFN
TRTLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAITN
SGGISPNVVQAQAEVLYLIRAPEMTDVQHIYDRVAKIAEGAALMTETTVECRFDKACSSY
LPNRTLENAMYQALSHFGTPEWNSEELAFAKQIQATLTSNDRQNSLNNIAATGGENGKVF
ALRHRETVLANEVAPYAATDNVLAASTDVGDVSWKLPVAQCFSPCFAVGTPLHTWQLVSQ
GRTSIAHKGMLLAAKTMAATTVNLFLDSGLLQECQQEHQQVTDTQPYHCPIPKNVTPSPL
K