Protein Info for b1336 in Escherichia coli BW25113

Name: ydaH
Annotation: putative pump protein (transport) (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 151 to 194 (44 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 470 to 495 (26 residues), see Phobius details TIGR00819: AbgT transporter family" amino acids 1 to 507 (507 residues), 930.4 bits, see alignment E=1.4e-284 PF03806: ABG_transport" amino acids 14 to 505 (492 residues), 692 bits, see alignment E=1.8e-212

Best Hits

Swiss-Prot: 100% identical to ABGT_ECOLI: p-aminobenzoyl-glutamate transport protein (abgT) from Escherichia coli (strain K12)

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 100% identity to eco:b1336)

MetaCyc: 100% identical to p-aminobenzoyl glutamate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-452

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46133 at UniProt or InterPro

Protein Sequence (508 amino acids)

>b1336 putative pump protein (transport) (VIMSS) (Escherichia coli BW25113)
MSMSSIPSSSQSGKLYGWVERIGNKVPHPFLLFIYLIIVLMVTTAILSAFGVSAKNPTDG
TPVVVKNLLSVEGLHWFLPNVIKNFSGFAPLGAILALVLGAGLAERVGLLPALMVKMASH
VNARYASYMVLFIAFFSHISSDAALVIMPPMGALIFLAVGRHPVAGLLAAIAGVGCGFTA
NLLIVTTDVLLSGISTEAAAAFNPQMHVSVIDNWYFMASSVVVLTIVGGLITDKIIEPRL
GQWQGNSDEKLQTLTESQRFGLRIAGVVSLLFIAAIALMVIPQNGILRDPINHTVMPSPF
IKGIVPLIILFFFVVSLAYGIATRTIRRQADLPHLMIEPMKEMAGFIVMVFPLAQFVAMF
NWSNMGKFIAVGLTDILESSGLSGIPAFVGLALLSSFLCMFIASGSAIWSILAPIFVPMF
MLLGFHPAFAQILFRIADSSVLPLAPVSPFVPLFLGFLQRYKPDAKLGTYYSLVLPYPLI
FLVVWLLMLLAWYLVGLPIGPGIYPRLS