Protein Info for b1326 in Escherichia coli BW25113

Name: mpaA
Annotation: murein peptide amidase A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00246: Peptidase_M14" amino acids 43 to 157 (115 residues), 47.7 bits, see alignment E=8.6e-17

Best Hits

Swiss-Prot: 100% identical to MPAA_ECOLI: Murein peptide amidase A (mpaA) from Escherichia coli (strain K12)

KEGG orthology group: K14054, protein MpaA (inferred from 100% identity to eco:b1326)

MetaCyc: 100% identical to murein tripeptide amidase A (Escherichia coli K-12 substr. MG1655)
RXN0-961

Predicted SEED Role

"Gamma-D-Glutamyl-meso-Diaminopimelate Amidase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACV6 at UniProt or InterPro

Protein Sequence (242 amino acids)

>b1326 murein peptide amidase A (RefSeq) (Escherichia coli BW25113)
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHGDENSSVVTLS
CALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAE
ERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPLACIEDPRHSELGEWLAQAFE
LPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEASEKYLFAMANLLRWHPKDAIR
PS