Protein Info for b1325 in Escherichia coli BW25113

Name: ycjG
Annotation: putative muconate cycloisomerase I (EC 5.5.-.-) (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF02746: MR_MLE_N" amino acids 1 to 112 (112 residues), 113.8 bits, see alignment E=5.6e-37 PF13378: MR_MLE_C" amino acids 132 to 317 (186 residues), 93.4 bits, see alignment E=1.8e-30

Best Hits

Swiss-Prot: 100% identical to AEEP_ECOLI: L-Ala-D/L-Glu epimerase (ycjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1325)

MetaCyc: 100% identical to L-Ala-D/L-Glu epimerase (Escherichia coli K-12 substr. MG1655)
RXN0-5228 [EC: 5.1.1.20]

Predicted SEED Role

"L-alanine-DL-glutamate epimerase" in subsystem Muconate lactonizing enzyme family

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P51981 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b1325 putative muconate cycloisomerase I (EC 5.5.-.-) (VIMSS) (Escherichia coli BW25113)
MRTVKVFEEAWPLHTPFVIARGSRSEARVVVVELEEEGIKGTGECTPYPRYGESDASVMA
QIMSVVPQLEKGLTREELQKILPAGAARNALDCALWDLAARRQQQSLADLIGITLPETVI
TAQTVVIGTPDQMANSASTLWQAGAKLLKVKLDNHLISERMVAIRTAVPDATLIVDANES
WRAEGLAARCQLLADLGVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSNLKALKGR
YEMVNIKLDKTGGLTEALALATEARAQGFSLMLGCMLCTSRAISAALPLVPQVSFADLDG
PTWLAVDVEPALQFTTGELHL