Protein Info for b1325 in Escherichia coli BW25113

Name: ycjG
Annotation: putative muconate cycloisomerase I (EC 5.5.-.-) (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 1 to 112 (112 residues), 113.8 bits, E=5.6e-37
• PF13378: MR_MLE_C
  • amino acids 132 to 317 (186 residues), 94.1 bits, E=1.1e-30

Best Hits

Swiss-Prot: 100% identical to AEEP_ECOLI: L-Ala-D/L-Glu epimerase (ycjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1325)

MetaCyc: 100% identical to L-Ala-D/L-Glu epimerase (Escherichia coli K-12 substr. MG1655)
RXN0-5228 [EC: 5.1.1.20]

Predicted SEED Role

"L-alanine-DL-glutamate epimerase" in subsystem Muconate lactonizing enzyme family

MetaCyc Pathways

• muropeptide degradation (4/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.20

Sequence Analysis Tools

See P51981 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b1325 putative muconate cycloisomerase I (EC 5.5.-.-) (VIMSS) (Escherichia coli BW25113)
MRTVKVFEEAWPLHTPFVIARGSRSEARVVVVELEEEGIKGTGECTPYPRYGESDASVMA
QIMSVVPQLEKGLTREELQKILPAGAARNALDCALWDLAARRQQQSLADLIGITLPETVI
TAQTVVIGTPDQMANSASTLWQAGAKLLKVKLDNHLISERMVAIRTAVPDATLIVDANES
WRAEGLAARCQLLADLGVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSNLKALKGR
YEMVNIKLDKTGGLTEALALATEARAQGFSLMLGCMLCTSRAISAALPLVPQVSFADLDG
PTWLAVDVEPALQFTTGELHL