Protein Info for b1314 in Escherichia coli BW25113

Name: b1314
Annotation: putative transient receptor potential locus (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01261: AP_endonuc_2" amino acids 19 to 262 (244 residues), 155.5 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 100% identical to YCJR_ECOLI: Probable ketose 3-epimerase (ycjR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1314)

MetaCyc: 100% identical to 3-dehydro-D-guloside 4-epimerase (Escherichia coli K-12 substr. MG1655)
RXN-20681

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76044 at UniProt or InterPro

Protein Sequence (262 amino acids)

>b1314 putative transient receptor potential locus (VIMSS) (Escherichia coli BW25113)
MKIGTQNQAFFPENILEKFRYIKEMGFDGFEIDGKLLVNNIEEVKAAIKETGLPVTTACG
GYDGWIGDFIEERRLNGLKQIERILEALAEVGGKGIVVPAAWGMFTFRLPPMTSPRSLDG
DRKMVSDSLRVLEQVAARTGTVVYLEPLNRYQDHMINTLADARRYIVENDLKHVQIIGDF
YHMNIEEDNLAQALHDNRDLLGHVHIADNHRYQPGSGTLDFHALFEQLRADNYQGYVVYE
GRIRAEDPAQAYRDSLAWLRTC