Protein Info for b1299 in Escherichia coli BW25113

Name: puuR
Annotation: DNA-binding transcriptional repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF13560: HTH_31" amino acids 9 to 64 (56 residues), 41.1 bits, see alignment E=4.6e-14 PF13443: HTH_26" amino acids 11 to 67 (57 residues), 22.3 bits, see alignment E=3.1e-08 PF01381: HTH_3" amino acids 13 to 66 (54 residues), 54.8 bits, see alignment E=1.9e-18 PF07883: Cupin_2" amino acids 111 to 178 (68 residues), 67.2 bits, see alignment E=2.1e-22 PF02311: AraC_binding" amino acids 123 to 169 (47 residues), 22.3 bits, see alignment E=2.4e-08

Best Hits

Swiss-Prot: 100% identical to PUUR_SHIFL: HTH-type transcriptional regulator PuuR (puuR) from Shigella flexneri

KEGG orthology group: K14056, HTH-type transcriptional regulator, repressor for puuD (inferred from 100% identity to eco:b1299)

Predicted SEED Role

"Putrescine utilization regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9U6 at UniProt or InterPro

Protein Sequence (185 amino acids)

>b1299 DNA-binding transcriptional repressor (NCBI) (Escherichia coli BW25113)
MSDEGLAPGKRLSEIRQQQGLSQRRAAELSGLTHSAISTIEQDKVSPAISTLQKLLKVYG
LSLSEFFSEPEKPDEPQVVINQDDLIEMGSQGVSMKLVHNGNPNRTLAMIFETYQPGTTT
GERIKHQGEEIGTVLEGEIVLTINGQDYHLVAGQSYAINTGIPHSFSNTSAGICRIISAH
TPTTF