Protein Info for b1298 in Escherichia coli BW25113

Name: ycjL
Annotation: probable amidotransferase subunit (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 8 to 224 (217 residues), 233.5 bits, E=2.6e-73
• PF00117: GATase
  • amino acids 95 to 241 (147 residues), 46.4 bits, E=3.9e-16

Best Hits

Swiss-Prot: 100% identical to PUUD_ECOLI: Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD (puuD) from Escherichia coli (strain K12)

KEGG orthology group: K09473, gamma-glutamyl-gamma-aminobutyrate hydrolase [EC: 3.5.1.94] (inferred from 100% identity to eco:b1298)

MetaCyc: 100% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
• superpathway of ornithine degradation (8/8 steps found)
• putrescine degradation II (4/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See P76038 at UniProt or InterPro

Protein Sequence (254 amino acids)

>b1298 probable amidotransferase subunit (VIMSS) (Escherichia coli BW25113)
MENIMNNPVIGVVMCRNRLKGHATQTLQEKYLNAIIHAGGLPIALPHALAEPSLLEQLLP
KLDGIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMAIINAALERRIPIFAICRGLQEL
VVATGGSLHRKLCEQPELLEHREDPELPVEQQYAPSHEVQVEEGGLLSALLPECSNFWVN
SLHGQGAKVVSPRLRVEARSPDGLVEAVSVINHPFALGVQWHPEWNSSEYALSRILFEGF
ITACQHHIAEKQRL