Protein Info for b1293 in Escherichia coli BW25113

Name: sapB
Annotation: predicted antimicrobial peptide transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 79 to 101 (23 residues), see Phobius details amino acids 113 to 141 (29 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 281 to 306 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 311 (220 residues), 144 bits, see alignment E=2.3e-46

Best Hits

Swiss-Prot: 100% identical to SAPB_ECOLI: Putrescine export system permease protein SapB (sapB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to eco:b1293)

MetaCyc: 100% identical to putrescine ABC exporter membrane subunit SapB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGH3 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b1293 predicted antimicrobial peptide transporter subunit (NCBI) (Escherichia coli BW25113)
MIIFTLRRILLLIVTLFLLTFVGFSLSYFTPHAPLQGASLWNAWVFWFNGLIHWDFGVSS
INGQPIAEQLKEVFPATMELCILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALLGFS
IPVFWLALLLTLFCSLTLGWLPVSGRFDLLYEVKPITGFALIDAWLSDSPWRDEMIMSAI
RHMILPVITLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPP
VIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLINAIRQQDYAAISAGVMVCGSLVIIVNV
ISDILGAMANPLKHKEWYALR