Protein Info for b1292 in Escherichia coli BW25113

Name: sapC
Annotation: predicted antimicrobial peptide transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 139 to 169 (31 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details PF12911: OppC_N" amino acids 16 to 66 (51 residues), 45.6 bits, see alignment 5.1e-16 PF00528: BPD_transp_1" amino acids 113 to 292 (180 residues), 68.5 bits, see alignment E=6.6e-23

Best Hits

Swiss-Prot: 100% identical to SAPC_ECOLI: Putrescine export system permease protein SapC (sapC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to eco:b1292)

MetaCyc: 100% identical to putrescine ABC exporter membrane protein SapC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGH5 at UniProt or InterPro

Protein Sequence (296 amino acids)

>b1292 predicted antimicrobial peptide transporter subunit (NCBI) (Escherichia coli BW25113)
MPYDSVYSEKRPPGTLRTAWRKFYSDASAMVGLYGCAGLAVLCIFGGWFAPYGIDQQFLG
YQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFVVTLAATICGLVLGTFA
GATHGLRSAVLNHILDTLLAIPSLLLAIIVVAFAGPSLSHAMFAVWLALLPRMVRSIYSM
VHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALGFLDLG
AQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAIIAGVE