Protein Info for b1285 in Escherichia coli BW25113

Name: gmr
Annotation: modulator of Rnase II stability (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 PF00989: PAS" amino acids 114 to 169 (56 residues), 28.1 bits, see alignment 3.6e-10 TIGR00229: PAS domain S-box protein" amino acids 115 to 233 (119 residues), 45.1 bits, see alignment E=1e-15 PF13426: PAS_9" amino acids 123 to 225 (103 residues), 35.5 bits, see alignment E=2e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 235 to 394 (160 residues), 118.1 bits, see alignment E=3.2e-38 PF00990: GGDEF" amino acids 237 to 390 (154 residues), 157.2 bits, see alignment E=6.4e-50 PF00563: EAL" amino acids 412 to 644 (233 residues), 227.4 bits, see alignment E=3.5e-71

Best Hits

Swiss-Prot: 100% identical to PDER_ECOLI: Cyclic di-GMP phosphodiesterase PdeR (pdeR) from Escherichia coli (strain K12)

KEGG orthology group: K14051, cyclic di-GMP phosphodiesterase Gmr [EC: 3.1.4.52] (inferred from 100% identity to eco:b1285)

MetaCyc: 100% identical to cyclic di-GMP phosphodiesterase PdeR (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"FIG00637999: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.52

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77334 at UniProt or InterPro

Protein Sequence (661 amino acids)

>b1285 modulator of Rnase II stability (NCBI) (Escherichia coli BW25113)
MKTVRESTTLYNFLGSHNPYWRLTESSDVLRFSTTETTEPDRTLQLSAEQAARIREMTVI
TSSLMMSLTVDESDLSVHLVGRKINKREWAGNASAWHDTPAVARDLSHGLSFAEQVVSEA
HSAIVILDSRGNIQRFNRLCEDYTGLKEHDVIGQSVFKLFMSRREAAASRRNNRVFFRSG
NAYEVELWIPTCKGQRLFLFRNKFVHSGSGKNEIFLICSGTDITEERRAQERLRILANTD
SITGLPNRNAMQDLIDHAINHADNNKVGVVYLDLDNFKKVNDAYGHLFGDQLLRDVSLAI
LSCLEHDQVLARPGGDEFLVLASNTSQSALEAMASRILTRLRLPFRIGLIEVYTSCSVGI
ALSPEHGSDSTAIIRHADTAMYTAKEGGRGQFCVFTPEMNQRVFEYLWLDTNLRKALEND
QLVIHYQPKITWRGEVRSLEALVRWQSPERGLIPPLDFISYAEESGLIVPLGRWVILDVV
RQVAKWRDKGINLRVAVNISARQLADQTIFTALKQVLQELNFEYCPIDVELTESCLIEND
ELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQVFVRDIHKQPVSQSLV
RAIVAVAQALNLQVIAEGVESAKEDAFLTKNGINERQGFLFAKPMPAVAFERWYKRYLKR
A