Protein Info for b1281 in Escherichia coli BW25113

Name: pyrF
Annotation: orotidine 5'-phosphate decarboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00215: OMPdecase" amino acids 16 to 237 (222 residues), 232.6 bits, see alignment E=2.7e-73 TIGR01740: orotidine 5'-phosphate decarboxylase" amino acids 17 to 237 (221 residues), 185 bits, see alignment E=7.6e-59

Best Hits

Swiss-Prot: 100% identical to PYRF_ECOLI: Orotidine 5'-phosphate decarboxylase (pyrF) from Escherichia coli (strain K12)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to eco:b1281)

MetaCyc: 100% identical to orotidine-5'-phosphate decarboxylase (Escherichia coli K-12 substr. MG1655)
Orotidine-5'-phosphate decarboxylase. [EC: 4.1.1.23]

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P08244 at UniProt or InterPro

Protein Sequence (245 amino acids)

>b1281 orotidine 5'-phosphate decarboxylase (NCBI) (Escherichia coli BW25113)
MTLTASSSSRAVTNSPVVVALDYHNRDDALAFVDKIDPRDCRLKVGKEMFTLFGPQFVRE
LQQRGFDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHASGGARMMTAAREALVPFGKD
APLLIAVTVLTSMEASDLVDLGMTLSPADYAERLAALTQKCGLDGVVCSAQEAVRFKQVF
GQEFKLVTPGIRPQGSEAGDQRRIMTPEQALSAGVDYMVIGRPVTQSVDPAQTLKAINAS
LQRSA