Protein Info for b1277 in Escherichia coli BW25113

Name: ribA
Annotation: GTP cyclohydrolase II protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00925: GTP_cyclohydro2
  • amino acids 5 to 170 (166 residues), 229.2 bits, E=1.1e-72
• TIGR00505: GTP cyclohydrolase II
  • amino acids 5 to 194 (190 residues), 317.8 bits, E=1e-99

Best Hits

Swiss-Prot: 100% identical to RIBA_ECO5E: GTP cyclohydrolase-2 (ribA) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 100% identity to eco:b1277)

MetaCyc: 100% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (4/7 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

See P0A7I7 at UniProt or InterPro

Protein Sequence (196 amino acids)

>b1277 GTP cyclohydrolase II protein (NCBI) (Escherichia coli BW25113)
MQLKRVAEAKLPTPWGDFLMVGFEELATGHDHVALVYGDISGHTPVLARVHSECLTGDAL
FSLRCDCGFQLEAALTQIAEEGRGILLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLGVNEVRLLTNNPKKVEILTEAGINIVERVPLIVGRNPNNE
HYLDTKAEKMGHLLNK