Protein Info for b1263 in Escherichia coli BW25113

Name: trpD
Annotation: bifunctional indole-3-glycerol-phosphate synthase/anthranilate phosphoribosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 4 to 186 (183 residues), 182.7 bits, E=6.6e-58
• PF00117: GATase
  • amino acids 5 to 186 (182 residues), 174.9 bits, E=3.1e-55
• PF07722: Peptidase_C26
  • amino acids 74 to 172 (99 residues), 24.1 bits, E=5.7e-09
• PF02885: Glycos_trans_3N
  • amino acids 201 to 263 (63 residues), 58.8 bits, E=7.3e-20
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 204 to 528 (325 residues), 430.8 bits, E=3.7e-133
• PF00591: Glycos_transf_3
  • amino acids 273 to 521 (249 residues), 345 bits, E=6.1e-107

Best Hits

Swiss-Prot: 100% identical to TRPGD_ECOLI: Bifunctional protein TrpGD (trpGD) from Escherichia coli (strain K12)

KEGG orthology group: K13497, anthranilate synthase/phosphoribosyltransferase [EC: 2.4.2.18 4.1.3.27] (inferred from 100% identity to eco:b1263)

MetaCyc: 100% identical to anthranilate synthase subunit TrpD (Escherichia coli K-12 substr. MG1655)
Anthranilate synthase. [EC: 4.1.3.27]; Anthranilate phosphoribosyltransferase. [EC: 4.1.3.27, 2.4.2.18]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18, 4.1.3.27

Use Curated BLAST to search for 2.4.2.18 or 4.1.3.27

Sequence Analysis Tools

See P00904 at UniProt or InterPro

Protein Sequence (531 amino acids)

>b1263 bifunctional indole-3-glycerol-phosphate synthase/anthranilate phosphoribosyltransferase (NCBI) (Escherichia coli BW25113)
MADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGV
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMF
AGLTNPLPVARYHSLVGSNIPAGLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGA
RLLEQTLAWAQQKLEPANTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALV
SMKIRGEHPNEIAGAATALLENAAPFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC
GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVLGYQRAAVVHSGG
MDEVSLHAPTIVAELHDGEIKSYQLTAEDFGLTPYHQEQLAGGTPEENRDILTRLLQGKG
DAAHEAAVAANVAMLMRLHGHEDLQANAQTVLEVLRSGSAYDRVTALAARG