Protein Info for b1252 in Escherichia coli BW25113

Name: tonB
Annotation: membrane spanning protein in TonB-ExbB-ExbD complex (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF16031: TonB_N" amino acids 33 to 157 (125 residues), 157.1 bits, see alignment E=3.8e-50 PF03544: TonB_C" amino acids 160 to 229 (70 residues), 71.8 bits, see alignment E=5.2e-24 TIGR01352: TonB family C-terminal domain" amino acids 161 to 233 (73 residues), 73.4 bits, see alignment E=7.6e-25

Best Hits

Swiss-Prot: 100% identical to TONB_ECOLI: Protein TonB (tonB) from Escherichia coli (strain K12)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 100% identity to eco:b1252)

MetaCyc: 100% identical to Ton complex subunit TonB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P02929 at UniProt or InterPro

Protein Sequence (239 amino acids)

>b1252 membrane spanning protein in TonB-ExbB-ExbD complex (NCBI) (Escherichia coli BW25113)
MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQA
VQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESR
PASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKF
DVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ