Protein Info for b1226 in Escherichia coli BW25113

Name: narJ
Annotation: molybdenum-cofactor-assembly chaperone subunit (delta subunit) of nitrate reductase 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00684: nitrate reductase molybdenum cofactor assembly chaperone
  • amino acids 8 to 161 (154 residues), 212.5 bits, E=1.5e-67
• PF02613: Nitrate_red_del
  • amino acids 43 to 158 (116 residues), 53.6 bits, E=1.2e-18

Best Hits

Swiss-Prot: 100% identical to NARJ_ECO57: Nitrate reductase molybdenum cofactor assembly chaperone NarJ (narJ) from Escherichia coli O157:H7

KEGG orthology group: K00373, nitrate reductase 1, delta subunit [EC: 1.7.99.4] (inferred from 100% identity to eco:b1226)

Predicted SEED Role

"Respiratory nitrate reductase delta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Sequence Analysis Tools

See P0AF26 at UniProt or InterPro

Protein Sequence (236 amino acids)

>b1226 molybdenum-cofactor-assembly chaperone subunit (delta subunit) of nitrate reductase 1 (NCBI) (Escherichia coli BW25113)
MIELVIVSRLLEYPDAALWQHQQEMFEAIAASKNLPKEDAHALGIFLRDLTTMDPLDAQA
QYSELFDRGRATSLLLFEHVHGESRDRGQAMVDLLAQYEQHGLQLNSRELPDHLPLYLEY
LAQLPQSEAVEGLKDIAPILALLSARLQQRESRYAVLFDLLLKLANTAIDSDKVAEKIAD
EARDDTPQALDAVWEEEQVKFFADKGCGDSAITAHQRRFAGAVAPQYLNITTGGQH