Protein Info for b1222 in Escherichia coli BW25113

Name: narX
Annotation: sensory histidine kinase in two-component regulatory system with NarL (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details PF13675: PilJ" amino acids 35 to 129 (95 residues), 34.3 bits, see alignment E=4.4e-12 PF00672: HAMP" amino acids 173 to 224 (52 residues), 42.9 bits, see alignment 1e-14 PF07730: HisKA_3" amino acids 390 to 453 (64 residues), 67.2 bits, see alignment E=3e-22 PF02518: HATPase_c" amino acids 496 to 585 (90 residues), 57.7 bits, see alignment E=3.1e-19

Best Hits

Swiss-Prot: 100% identical to NARX_SHIFL: Nitrate/nitrite sensor protein NarX (narX) from Shigella flexneri

KEGG orthology group: K07673, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarX [EC: 2.7.13.3] (inferred from 100% identity to eco:b1222)

MetaCyc: 100% identical to sensor histidine kinase NarX (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFA2 at UniProt or InterPro

Protein Sequence (598 amino acids)

>b1222 sensory histidine kinase in two-component regulatory system with NarL (NCBI) (Escherichia coli BW25113)
MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL
LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR
ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ
PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG
LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF
TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ
LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG
DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV
KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG
VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE