Protein Info for b1183 in Escherichia coli BW25113

Name: umuD
Annotation: DNA polymerase V, subunit D (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00717: Peptidase_S24
  • amino acids 16 to 132 (117 residues), 103.5 bits, E=3e-34

Best Hits

Swiss-Prot: 100% identical to UMUD_SHIFL: Protein UmuD (umuD) from Shigella flexneri

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 100% identity to eco:b1183)

MetaCyc: 100% identical to DNA polymerase V protein UmuD (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone repair protein UmuD"

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7, 3.4.21.-

Use Curated BLAST to search for 2.7.7.7 or 3.4.21.-

Sequence Analysis Tools

See P0AG11 at UniProt or InterPro

Protein Sequence (139 amino acids)

>b1183 DNA polymerase V, subunit D (NCBI) (Escherichia coli BW25113)
MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDS
MIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITIS
SEDTLDVFGVVIHVVKAMR