Protein Info for b1130 in Escherichia coli BW25113

Name: phoP
Annotation: DNA-binding response regulator in two-component regulatory system with PhoQ (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 91.2 bits, see alignment E=5.1e-30 PF00486: Trans_reg_C" amino acids 146 to 220 (75 residues), 68.5 bits, see alignment E=4.5e-23

Best Hits

Swiss-Prot: 100% identical to PHOP_ECOLI: Transcriptional regulatory protein PhoP (phoP) from Escherichia coli (strain K12)

KEGG orthology group: K07660, two-component system, OmpR family, response regulator PhoP (inferred from 100% identity to eco:b1130)

Predicted SEED Role

"Transcriptional regulatory protein PhoP" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23836 at UniProt or InterPro

Protein Sequence (223 amino acids)

>b1130 DNA-binding response regulator in two-component regulatory system with PhoQ (NCBI) (Escherichia coli BW25113)
MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGL
SLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNS
GLASQVISLPPFQVDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYP
DAELRESHTIDVLMGRLRKKIQAQYPQEVITTVRGQGYLFELR