Protein Info for b1124 in Escherichia coli BW25113

Name: potC
Annotation: spermidine/putrescine ABC transporter membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 253 (179 residues), 70.6 bits, see alignment E=7.2e-24

Best Hits

Swiss-Prot: 100% identical to POTC_ECO57: Spermidine/putrescine transport system permease protein PotC (potC) from Escherichia coli O157:H7

KEGG orthology group: K11070, spermidine/putrescine transport system permease protein (inferred from 100% identity to eco:b1124)

MetaCyc: 100% identical to spermidine preferential ABC transporter membrane subunit PotC (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFK6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>b1124 spermidine/putrescine ABC transporter membrane protein (NCBI) (Escherichia coli BW25113)
MIGRLLRGGFMTAIYAYLYIPIIILIVNSFNSSRFGINWQGFTTKWYSLLMNNDSLLQAA
QHSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFM
LLGIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
AMPAVAAGWVLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVL
SLVMVIASQLIARDKTKGNTGDVK