Protein Info for b1119 in Escherichia coli BW25113

Name: nagK
Annotation: N-acetyl-D-glucosamine kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 122 to 140 (19 residues), see Phobius details PF00480: ROK" amino acids 2 to 300 (299 residues), 236.4 bits, see alignment E=5.1e-74 PF02685: Glucokinase" amino acids 6 to 256 (251 residues), 33.9 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 100% identical to NAGK_ECOSE: N-acetyl-D-glucosamine kinase (nagK) from Escherichia coli (strain SE11)

KEGG orthology group: K00884, N-acetylglucosamine kinase [EC: 2.7.1.59] (inferred from 100% identity to eco:b1119)

MetaCyc: 100% identical to N-acetyl-D-glucosamine kinase (Escherichia coli K-12 substr. MG1655)
N-acetylglucosamine kinase. [EC: 2.7.1.59]

Predicted SEED Role

"N-acetyl-D-glucosamine kinase (EC 2.7.1.59)" (EC 2.7.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75959 at UniProt or InterPro

Protein Sequence (303 amino acids)

>b1119 N-acetyl-D-glucosamine kinase (NCBI) (Escherichia coli BW25113)
MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG
QHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNI
LTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH
LTD