Protein Info for b1048 in Escherichia coli BW25113

Name: mdoG
Annotation: glucan biosynthesis protein, periplasmic (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04349: MdoG" amino acids 23 to 506 (484 residues), 663 bits, see alignment E=1.6e-203

Best Hits

Swiss-Prot: 100% identical to OPGG_ECOLI: Glucans biosynthesis protein G (mdoG) from Escherichia coli (strain K12)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 100% identity to eco:b1048)

Predicted SEED Role

"Glucans biosynthesis protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33136 at UniProt or InterPro

Protein Sequence (511 amino acids)

>b1048 glucan biosynthesis protein, periplasmic (NCBI) (Escherichia coli BW25113)
MMKMRWLSAAVMLTLYTSSSWAFSIDDVAKQAQSLAGKGYETPKSNLPSVFRDMKYADYQ
QIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPDYFTFGDVQH
DKDTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDTALP
SGEEFPRFKEFWIERPKPTDKRLTIYALLDSPRATGAYKFVVMPGRDTVVDVQSKIYLRD
KVGKLGVAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHLAVS
SFSMENPQGFGLLQRGRDFSRFEDLDDRYDLRPSAWVTPKGEWGKGSVELVEIPTNDETN
DNIVAYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAWVQQTRRSTGDVKQSNLIRQ
PDGTIAFVVDFTGAEMKKLPEDTPVTAQTSIGDNGEIVESTVRYNPVTKGWRLVMRVKVK
DAKKTTEMRAALVNADQTLSETWSYQLPANE