Protein Info for b1047 in Escherichia coli BW25113

Name: mdoC
Annotation: glucans biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 10 to 356 (347 residues), 157.1 bits, see alignment E=3.1e-50

Best Hits

Swiss-Prot: 100% identical to OPGC_ECOBW: Glucans biosynthesis protein C (mdoC) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K11941, glucans biosynthesis protein C [EC: 2.1.-.-] (inferred from 100% identity to eco:b1047)

Predicted SEED Role

"Glucans biosynthesis protein C (EC 2.1.-.-)" (EC 2.1.-.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75920 at UniProt or InterPro

Protein Sequence (385 amino acids)

>b1047 glucans biosynthesis protein (NCBI) (Escherichia coli BW25113)
MNPVPAQREYFLDSIRAWLMLLGIPFHISLIYSSHTWHVNSAESSLWLTLFNDFIHSFRM
QVFFVISGYFSYMLFLRYPLKKWWKVRVERVGIPMLTAIPLLTLPQFIMLQYVKGKAESW
PGLSLYDKYNTLAWELISHLWFLLVLVVMTTLCVWIFKRIRNNLENSDKTNKKFSMVKLS
VIFLCLGIGYAVIRRTIFIVYPPILSNGMFNFIVMQTLFYLPFFILGALAFIFPHLKALF
TTPSRGCTLAAALAFVAYLLNQRYGSGDAWMYETESVITMVLGLWMVNVVFSFGHRLLNF
QSARVTYFVNASLFIYLVHHPLTLFFGAYITPHITSNWLGFLCGLIFVVGIAIILYEIHL
RIPLLKFLFSGKPVVKRENDKAPAR