Protein Info for b1045 in Escherichia coli BW25113

Name: ymdB
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF01661: Macro" amino acids 21 to 137 (117 residues), 153.5 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 100% identical to YMDB_ECO57: O-acetyl-ADP-ribose deacetylase (ymdB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1045)

MetaCyc: 100% identical to 2'-O-acetyl-ADP-ribose deacetylase, regulator of RNase III activity (Escherichia coli K-12 substr. MG1655)
RXN0-7013 [EC: 3.1.1.106]

Predicted SEED Role

"COG2110, Macro domain, possibly ADP-ribose binding module"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A8D6 at UniProt or InterPro

Protein Sequence (177 amino acids)

>b1045 hypothetical protein (NCBI) (Escherichia coli BW25113)
MKTRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC
PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA
ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLTQQGDE