Protein Info for b1039 in Escherichia coli BW25113

Name: csgE
Annotation: predicted transport protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF10627: CsgE" amino acids 27 to 128 (102 residues), 111.1 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 100% identical to CSGE_ECO57: Curli production assembly/transport component CsgE (csgE) from Escherichia coli O157:H7

KEGG orthology group: K04337, curli production assembly/transport component CsgE (inferred from 100% identity to eco:b1039)

Predicted SEED Role

"Curli production assembly/transport component CsgE" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE95 at UniProt or InterPro

Protein Sequence (129 amino acids)

>b1039 predicted transport protein (NCBI) (Escherichia coli BW25113)
MKRYLRWIVAAEFLFAAGNLHAVEVEVPGLLTDHTVSSIGHDFYRAFSDKWESDYTGNLT
INERPSARWGSWITITVNQDVIFQTFLFPLKRDFEKTVVFALIQTEEALNRRQINQALLS
TGDLAHDEF