Protein Info for b1029 in Escherichia coli BW25113

Name: ycdU
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 16 to 32 (17 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YCDU_ECOLI: Uncharacterized protein YcdU (ycdU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1029)

Predicted SEED Role

"Uncharacterized protein YcdU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75910 at UniProt or InterPro

Protein Sequence (328 amino acids)

>b1029 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MIPDYLTFIRFQDKRNLIYIYAIGLILIGFYWKNAGFTFPSEDIGVVSGILALVLYNFIF
DLKAYWAYKCVTKNIDFSWFKKKQNHKIELFLTQPLVAGFLSLIMLSAMSWGLYQLLPSL
YALFLISLLGPLVIFLLFRMIRTSYVKQVAISVAKKVKYKSLTRYVLLSVCISTVVNLLT
ISPLRNSDSFVTEGQWLTFKSIIALLILCGVVLAINLFFLRFSKRYAFLGRLFLQEIDLF
FSSENALSTFFAKPLWLRLFILLVIEVMWITLVSVLATLVEWRIWFEAYFLLCYVPCLIY
YFFYCRFLWHNDFMMACDMYFRWGHFNK