Protein Info for b1021 in Escherichia coli BW25113

Name: ycdP
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03940: poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD
  • amino acids 3 to 126 (124 residues), 55.4 bits, E=3.2e-19
• PF13994: PgaD
  • amino acids 4 to 125 (122 residues), 52.6 bits, E=2.7e-18

Best Hits

Swiss-Prot: 100% identical to PGAD_ECOLI: Biofilm PGA synthesis protein PgaD (pgaD) from Escherichia coli (strain K12)

KEGG orthology group: K11937, biofilm PGA synthesis protein PgaD (inferred from 100% identity to eco:b1021)

MetaCyc: 100% identical to poly-N-acetyl-D-glucosamine synthase subunit PgaD (Escherichia coli K-12 substr. MG1655)
2.4.1.M63 [EC: 2.4.1.M63]; TRANS-RXN0-549 [EC: 2.4.1.M63]

Predicted SEED Role

"Biofilm PGA synthesis auxiliary protein PgaD"

MetaCyc Pathways

• poly-β-1,6-N-acetyl-D-glucosamine biosynthesis (4/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.M63

Sequence Analysis Tools

See P69432 at UniProt or InterPro

Protein Sequence (137 amino acids)

>b1021 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL
AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT
SQGQIKMVVSEKALVRA