Protein Info for b1011 in Escherichia coli BW25113

Name: b1011
Annotation: putative synthetase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03614: pyrimidine utilization protein B
  • amino acids 3 to 226 (224 residues), 457.4 bits, E=4.2e-142
• PF00857: Isochorismatase
  • amino acids 18 to 215 (198 residues), 143 bits, E=5.7e-46

Best Hits

Swiss-Prot: 100% identical to RUTB_ECODH: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 100% identity to eco:b1011)

MetaCyc: 100% identical to ureidoacrylate amidohydrolase / (+)-gamma-lactamase monomer (Escherichia coli K-12 JM109)
3.5.2.-; RXN0-6460 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• allantoin degradation IV (anaerobic) (8/9 steps found)
• uracil degradation III (5/5 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea degradation I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Sequence Analysis Tools

See P75897 at UniProt or InterPro

Protein Sequence (230 amino acids)

>b1011 putative synthetase (VIMSS) (Escherichia coli BW25113)
MTTLTARPEAITFDPQQSALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAA
RAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVD
ELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYF
GVVLEDATHQAGPKFAQKAALFNIETFFGWVSDVETFCDALSPTSFAHIA