Protein Info for b1006 in Escherichia coli BW25113

Name: ycdG
Annotation: putative transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 76 (17 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 385 to 425 (41 residues), see Phobius details TIGR03616: pyrimidine utilization transport protein G" amino acids 1 to 428 (428 residues), 848.7 bits, see alignment E=7.7e-260 TIGR00801: uracil-xanthine permease" amino acids 26 to 424 (399 residues), 397.9 bits, see alignment E=5.5e-123 PF00860: Xan_ur_permease" amino acids 31 to 401 (371 residues), 349.5 bits, see alignment E=1e-108

Best Hits

Swiss-Prot: 100% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: K09016, putative pyrimidine permease RutG (inferred from 100% identity to eco:b1006)

MetaCyc: 100% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75892 at UniProt or InterPro

Protein Sequence (442 amino acids)

>b1006 putative transport protein (VIMSS) (Escherichia coli BW25113)
MAMFGFPHWQLKSTSTESGVVAPDERLPFAQTAVMGVQHAVAMFGATVLMPILMGLDPNL
SILMSGIGTLLFFFITGGRVPSYLGSSAAFVGVVIAATGFNGQGINPNISIALGGIIACG
LVYTVIGLVVMKIGTRWIERLMPPVVTGAVVMAIGLNLAPIAVKSVSASAFDSWMAVMTV
LCIGLVAVFTRGMIQRLLILVGLIVACLLYGVMTNVLGLGKAVDFTLVSHAAWFGLPHFS
TPAFNGQAMMLIAPVAVILVAENLGHLKAVAGMTGRNMDPYMGRAFVGDGLATMLSGSVG
GSGVTTYAENIGVMAVTKVYSTLVFVAAAVIAMLLGFSPKFGALIHTIPAAVIGGASIVV
FGLIAVAGARIWVQNRVDLSQNGNLIMVAVTLVLGAGDFALTLGGFTLGGIGTATFGAIL
LNALLSRKLVDVPPPEVVHQEP