Protein Info for b1000 in Escherichia coli BW25113

Name: cbpA
Annotation: curved DNA-binding protein, DnaJ homologue that functions as a co-chaperone of DnaK (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00226: DnaJ" amino acids 5 to 66 (62 residues), 85.3 bits, see alignment E=2.4e-28 PF01556: DnaJ_C" amino acids 120 to 276 (157 residues), 144.7 bits, see alignment E=2.4e-46

Best Hits

Swiss-Prot: 100% identical to CBPA_ECOLC: Curved DNA-binding protein (cbpA) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K05516, curved DNA-binding protein (inferred from 100% identity to eco:b1000)

Predicted SEED Role

"DnaJ-class molecular chaperone CbpA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P36659 at UniProt or InterPro

Protein Sequence (306 amino acids)

>b1000 curved DNA-binding protein, DnaJ homologue that functions as a co-chaperone of DnaK (NCBI) (Escherichia coli BW25113)
MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQ
RRAEYDQMWQHRNDPQFNRQFHHGDGQSFNAEDFDDIFSSIFGQHARQSRQRPATRGHDI
EIEVAVFLEETLTEHKRTISYNLPVYNAFGMIEQEIPKTLNVKIPAGVGNGQRIRLKGQG
TPGENGGPNGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKESILLT
IPPGSQAGQRLRVKGKGLVSKKQTGDLYAVLKIVMPPKPDENTAALWQQLADAQSSFDPR
KDWGKA