Protein Info for b0992 in Escherichia coli BW25113

Name: yccM
Annotation: predicted 4Fe-4S membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details PF12801: Fer4_5" amino acids 97 to 142 (46 residues), 53.9 bits, see alignment 5.7e-18 amino acids 201 to 246 (46 residues), 38.1 bits, see alignment 4.9e-13 PF13237: Fer4_10" amino acids 243 to 289 (47 residues), 33.4 bits, see alignment 1.4e-11 PF12837: Fer4_6" amino acids 244 to 264 (21 residues), 24.6 bits, see alignment (E = 7.2e-09) PF12798: Fer4_3" amino acids 251 to 264 (14 residues), 13.4 bits, see alignment (E = 5e-05) amino acids 278 to 290 (13 residues), 15.9 bits, see alignment (E = 7.6e-06)

Best Hits

Swiss-Prot: 100% identical to YCCM_ECOLI: Putative electron transport protein YccM (yccM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0992)

Predicted SEED Role

"Hypothetical iron-sulfur cluster binding protein YccM" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52636 at UniProt or InterPro

Protein Sequence (357 amino acids)

>b0992 predicted 4Fe-4S membrane protein (NCBI) (Escherichia coli BW25113)
MAENKRTRWQRRPGTTGGKLPWNDWRNATTWRKATQLLLLAMNIYIAITFWYWVRYYETA
SSTTFVARPGGIEGWLPIAGLMNLKYSLVTGQLPSVHAAAMLLLVAFIVISLLLKKAFCS
WLCPVGTLSELIGDLGNKLFGRQCVLPRWLDIPLRGVKYLLLSFFIYIALLMPAQAIHYF
MLSPYSVVMDVKMLDFFRHMGTATLISVTVLLIASLFIRHAWCRYLCPYGALMGVVSLLS
PFKIRRNAESCIDCGKCAKNCPSRIPVDKLIQVRTVECTGCMTCVESCPVASTLTFSLQK
PAANKKAFALSGWLMTLLVLGIMFAVIGYAMYAGVWQSPVPEELYRRLIPQAPMIGH