Protein Info for b0978 in Escherichia coli BW25113

Name: appC
Annotation: cytochrome bd-II oxidase, subunit I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 471 to 492 (22 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 7 to 501 (495 residues), 580.5 bits, see alignment E=8.4e-179

Best Hits

Swiss-Prot: 100% identical to APPC_ECOLI: Cytochrome bd-II ubiquinol oxidase subunit 1 (appC) from Escherichia coli (strain K12)

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to eco:b0978)

MetaCyc: 100% identical to cytochrome bd-II subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P26459 at UniProt or InterPro

Protein Sequence (514 amino acids)

>b0978 cytochrome bd-II oxidase, subunit I (NCBI) (Escherichia coli BW25113)
MWDVIDLSRWQFALTALYHFLFVPLTLGLIFLLAIMETIYVVTGKTIYRDMTRFWGKLFG
INFALGVATGLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQR
LNKYQHLLVTWLVAFGSNLSALWILNANGWMQYPTGAHFDIDTLRMEMTSFSELVFNPVS
QVKFVHTVMAGYVTGAMFIMAISAWYLLRGRERNVALRSFAIGSVFGTLAIIGTLQLGDS
SAYEVAQVQPVKLAAMEGEWQTEPAPAPFHVVAWPEQDQERNAFALKIPALLGILATHSL
DKPVPGLKNLMAETYPRLQRGRMAWLLMQEISQGNREPHVLQAFRGLEGDLGYGMLLSRY
APDMNHVTAAQYQAAMRGAIPQVAPVFWSFRIMVGCGSLLLLVMLIALVQTLRGKIDQHR
WVLKMALWSLPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHSALTTGQLAFSLIMIVG
LYTLFLIAEVYLMQKYARLGPSAMQSEQPTQQQG