Protein Info for b0974 in Escherichia coli BW25113

Name: hyaC
Annotation: hydrogenase 1, b-type cytochrome subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 101 to 115 (15 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details TIGR02125: Ni/Fe-hydrogenase, b-type cytochrome subunit" amino acids 12 to 225 (214 residues), 262 bits, see alignment E=1.8e-82 PF01292: Ni_hydr_CYTB" amino acids 14 to 220 (207 residues), 134.5 bits, see alignment E=1.8e-43

Best Hits

Swiss-Prot: 100% identical to CYBH_ECO57: Probable Ni/Fe-hydrogenase 1 B-type cytochrome subunit (hyaC) from Escherichia coli O157:H7

KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 100% identity to eco:b0974)

MetaCyc: 100% identical to hydrogenase 1 cytochrome b subunit (Escherichia coli K-12 substr. MG1655)
1.12.98.-; Hydrogen:quinone oxidoreductase. [EC: 1.12.5.1]

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAM1 at UniProt or InterPro

Protein Sequence (235 amino acids)

>b0974 hydrogenase 1, b-type cytochrome subunit (NCBI) (Escherichia coli BW25113)
MQQKSDNVVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIR
LIHFSAGMVFTVVLLMRIYWAFVGNRYSRELFIVPVWRKSWWQGVWYEIRWYLFLAKRPS
ADIGHNPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFYWTGGNSMDI
HSWHRLGMWLIGAFVIGHVYMALREDIMSDDTVISTMVNGYRSHKFGKISNKERS